DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG18754

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:271 Identity:57/271 - (21%)
Similarity:93/271 - (34%) Gaps:91/271 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GPKDIIVNGYP-----AYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL------------ 77
            |.::..:|.||     .||.:.                |:|  .:|||||||:            
  Fly   108 GAENAELNEYPWMVLLLYENRL----------------SLI--RYVLTAAHCVIGGYLTQNDLVL 154

  Fly    78 --------TTDSVT---------IHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAG---HDIGLI 122
                    |||.:|         :..|         |.||       |.|:.:|.|   :||.|:
  Fly   155 KSVRLGESTTDCITSESRCPHLDVEVG---------QTTV-------HQGFTSSGGTYRNDIALL 203

  Fly   123 RTPY-VSFTNLINKVSL--PKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECA 184
            |..: |.:|..|..:.|  .:|..:....:     ..||....:   :..|....|:..:..:|.
  Fly   204 RLQFPVRYTKKIQPICLLDAEFPLQDLNLQ-----ISGWDPTKS---SQTLITSTVKERNPADCL 260

  Fly   185 RSYGSVAS-TDMCTRATDGKSVCGGDSGGALV------THDNPIQVGVITFASIGCKSG--PSGY 240
            ..|.|..| :.:|.........|.|.||..::      ..:.....|:.::....|.|.  |..|
  Fly   261 NRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVY 325

  Fly   241 TRVSDHLDWIR 251
            |::....:||:
  Fly   326 TKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 56/266 (21%)
Tryp_SPc 35..250 CDD:214473 54/263 (21%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 57/271 (21%)
Tryp_SPc 108..335 CDD:214473 55/268 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.