DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and ctrl

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:230 Identity:82/230 - (35%)
Similarity:119/230 - (51%) Gaps:21/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNG-AVGGGSVIGNNWVLTAAHCLTTDSVTIHYGS-NRAWNGQLQ 97
            ||||..|..|..|:.|.|:.:.| ...|||||.:.||:|||||..|.:..:..|. :|:...:..
 Frog    34 IVNGENAVPGSWPWQVSLQDSTGFHFCGGSVISDFWVVTAAHCGVTTAHRVILGEYDRSSPAEPI 98

  Fly    98 HTVNKNNFFRHPGYPN-SAGHDIGLIR--TPYVSFTNLINKVSLPKFSQK---GERFENWWCVAC 156
            .|......||||.|.: :..:||.|::  :| .||:|::..|.:...|..   |||     ||..
 Frog    99 QTKTIAKVFRHPNYNSFTIANDITLLKLSSP-ASFSNIVAPVCVASSSDAFNGGER-----CVTT 157

  Fly   157 GWG--GMANGGLADWLQCMDVQVISNGECARSYGS-VASTDMCTRATDGKSVCGGDSGGALVTHD 218
            |||  ..|:....:.||.:.:.::||.||.|.:|| :.:|.:|..|: |.|.|.|||||.||...
 Frog   158 GWGYVDAASRLTPNKLQQVALPLLSNTECQRYWGSKILNTMVCAGAS-GASSCMGDSGGPLVCQR 221

  Fly   219 NP--IQVGVITFASIGCK-SGPSGYTRVSDHLDWI 250
            |.  :..|::::.|..|. |.|..|.|||....|:
 Frog   222 NGAWVLAGIVSWGSSTCSPSSPGVYARVSTLRSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 82/230 (36%)
Tryp_SPc 35..250 CDD:214473 81/228 (36%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 82/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.