DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and prss27

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:247 Identity:80/247 - (32%)
Similarity:110/247 - (44%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL----TTDSVTIHYGS---NRAW 92
            |:.|..|.||:.|:.|..|.|.|...||::|...:|::||||.    :..|||...|:   ::..
 Frog    34 IMGGQSAQEGQWPWQVSFRNNGGHFCGGTLISKQYVISAAHCFPSSSSASSVTAVLGAYMIDQPD 98

  Fly    93 NGQLQHTVNKNNFFRHPGYPNSA-GHDIGLIR--TPYVSFTNLINKVSLPKFS---QKGERFENW 151
            ..|:...|....  .:|.|.|.. ..||.|::  :| |:|||.|..|.||..:   ..|.:    
 Frog    99 GNQVAIPVQSAT--NYPSYVNEGDSGDISLVQLASP-VTFTNYILPVCLPADTVTFPTGLQ---- 156

  Fly   152 WCVACGWGGMANG-GLAD--WLQCMDVQVISNGEC------ARSYG----SVASTDMCTR-ATDG 202
             |...|||.:|:. .|..  .||.:.|.:|...||      ..|||    ||.|..:|.. ...|
 Frog   157 -CWVTGWGNIASDVSLVSPMTLQEVAVPLIDANECNALYQTPNSYGTSSISVHSDMICAGFINGG 220

  Fly   203 KSVCGGDSGGALVTHDNP--IQVGVITFASIGCKSG--PSGYTRVSDHLDWI 250
            |..|.|||||.||...:.  ...||::|.. ||...  |..||.:..:.|||
 Frog   221 KDSCQGDSGGPLVCSSSGQWFLAGVVSFGE-GCGQAYRPGVYTLMPSYTDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 80/247 (32%)
Tryp_SPc 35..250 CDD:214473 78/245 (32%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 78/245 (32%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.