DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and ctrl

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:235 Identity:78/235 - (33%)
Similarity:109/235 - (46%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNG-AVGGGSVIGNNWVLTAAHCLTTDSVTIHY---GSNRAWNGQ 95
            ||||..|..|..|:.|.|:.:|| ...|||:|...||:|||||..  ....||   |.:.  .|.
Zfish    32 IVNGENAVSGSWPWQVSLQQSNGFHFCGGSLINQYWVVTAAHCRV--QAGYHYVILGEHD--RGS 92

  Fly    96 LQHTVNKNNFFR---HPGYPNSA--GHDIGLIR--TPYVSFTNLINKVSLPKFS---QKGERFEN 150
            ...:|...:..:   || |.||.  .:||.|::  :| ...|:.|:.|.|...|   ..|.|   
Zfish    93 SAESVQVKSIAKAITHP-YYNSQNFNNDITLLKLSSP-AQLTSRISPVCLAASSTSIPSGTR--- 152

  Fly   151 WWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYGSVASTD--MCTRATDGKSVCGGDSGGA 213
              ||..|||...:......||...:.::|..:|.:.:|....||  :|..|: |.|.|.|||||.
Zfish   153 --CVTTGWGKTGSTSSPRILQQTALPLLSPAQCKQYWGQNRITDAMICAGAS-GVSSCQGDSGGP 214

  Fly   214 LVTHDNP--IQVGVITFASIGCK-SGPSGYTRVSDHLDWI 250
            ||...:.  .|||::::.:..|. ..|:.|.|||....||
Zfish   215 LVCESSGAWYQVGIVSWGTSDCNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 78/235 (33%)
Tryp_SPc 35..250 CDD:214473 76/233 (33%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 76/233 (33%)
Tryp_SPc 32..257 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.