DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:123/266 - (46%)
Similarity:162/266 - (60%) Gaps:16/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLFVATVCAHRNRNRTAHHGGGP---KDI-----IVNGYPAYEGKAPYAVGLRM--NNGAVGGG 62
            ||:|:|...|......|......|   ||:     |.|||||||||.||.|||..  |.....||
  Fly     3 LLVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 67

  Fly    63 SVIGNNWVLTAAHCLT-TDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGH-DIGLIRTP 125
            |:|||.||||||||.. ...|||:||::.....|..|.|...||.:|..|.:...| ||.|||||
  Fly    68 SIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTP 132

  Fly   126 YVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGG-LADWLQCMDVQVISNGECARSYGS 189
            :|.|.:|:|||.||.::.:.:.:..||.||.||||..:|. |.||||.:|||::|..:|:|:: |
  Fly   133 HVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTW-S 196

  Fly   190 VASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITF-ASIGCKSG-PSGYTRVSDHLDWIRE 252
            :....:|.....|||.|||||||.||||:....|||.:| :|.||:|| |:.::||:.:|||||:
  Fly   197 LHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRD 261

  Fly   253 KSGIAY 258
            .:||:|
  Fly   262 NTGISY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 111/224 (50%)
Tryp_SPc 35..250 CDD:214473 108/221 (49%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 108/222 (49%)
Tryp_SPc 38..262 CDD:238113 111/224 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.