DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:239 Identity:117/239 - (48%)
Similarity:153/239 - (64%) Gaps:13/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KDI-----IVNGYPAYEGKAPYAVGLRM--NNGAVGGGSVIGNNWVLTAAHCLT-TDSVTIHYGS 88
            ||:     |.|||||||||.||.|||..  |.....|||:|||.||||||||.. ...|||:||:
  Fly    30 KDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA 94

  Fly    89 NRAWNGQLQHTVNKNNFFRHPGYPNSAGH-DIGLIRTPYVSFTNLINKVSLPKFSQKGERFENWW 152
            :.....|..|.|...||.:|..|.:...| ||.|||||:|.|.:|:|||.||.::.:.:.:..||
  Fly    95 SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYNDRYQDYAGWW 159

  Fly   153 CVACGWGGMANGG-LADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVT 216
            .||.||||..:|. |.||||.:|||::|..:|:||: |:....:|.....|||.|||||||.|||
  Fly   160 AVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSW-SLHDNMICINTNGGKSTCGGDSGGPLVT 223

  Fly   217 HDNPIQVGVITF-ASIGCKSG-PSGYTRVSDHLDWIREKSGIAY 258
            |:....|||.:| :|.||:|| |:.::||:.:|||||:.:||:|
  Fly   224 HEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTGISY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 112/224 (50%)
Tryp_SPc 35..250 CDD:214473 109/221 (49%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 109/222 (49%)
Tryp_SPc 38..262 CDD:238113 112/224 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470744
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.