DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:237 Identity:117/237 - (49%)
Similarity:151/237 - (63%) Gaps:11/237 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KDI---IVNGYPAYEGKAPYAVGLRM--NNGAVGGGSVIGNNWVLTAAHCLT-TDSVTIHYGSNR 90
            |||   |.|||||||||.||.|||..  |.....|||:|||.||||||||.. ...|||:||::.
  Fly    30 KDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASI 94

  Fly    91 AWNGQLQHTVNKNNFFRHPGYPNSAGH-DIGLIRTPYVSFTNLINKVSLPKFSQKGERFENWWCV 154
            ....|..|.|...:..:|..|.:...| ||.|||||:|.|.:|:|||.||.::.:.:.:..||.|
  Fly    95 RTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAV 159

  Fly   155 ACGWGGMANGG-LADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHD 218
            |.||||..:|. |.||||.:|||:||..:|:|:: |:....:|.....|||.|||||||.|||||
  Fly   160 ASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTW-SLHDNMICINTDGGKSTCGGDSGGPLVTHD 223

  Fly   219 NPIQVGVITFAS-IGCKSG-PSGYTRVSDHLDWIREKSGIAY 258
            ....|||.:|.| .||:|| |:.::||:.:|||||:.:||:|
  Fly   224 GNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 111/224 (50%)
Tryp_SPc 35..250 CDD:214473 108/221 (49%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 111/224 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.