DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG11843

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:111/253 - (43%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIVNGYPAYEGKAPY--AVGLRMNNGAVG----GGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAW 92
            :||.|:||...:.|:  .:|.|.:..:..    ||.:|...:||||||||.::...:    |...
  Fly    67 LIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEV----NVVR 127

  Fly    93 NGQLQ-HTVNKN---------NFFRHPGYPN-SAGHDIGLIR-TPYVSFTNLINKVSLP-KFSQK 144
            .|:|. .:::::         .:..||||.: ...|||||:: |..|.|....:...|| :..:.
  Fly   128 LGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERS 192

  Fly   145 GERFENWWCVACGWG--GMANGGLADWLQCMDVQVISNGECAR---------SYGSVASTDMCTR 198
            .:.|     :|.|||  |:|....|..|: :.:|...|..|.:         ..|...:..:|..
  Fly   193 SDSF-----IAVGWGSTGLALKPSAQLLK-VKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVG 251

  Fly   199 ATDGKSVCGGDSGGALVTH--DNPIQVGVITFASIGCKSGPSG----YTRVSDHLDWI 250
            :...:..|.|||||.|:.:  :.|....|:...|.|...|..|    ||||..:|.||
  Fly   252 SEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 70/252 (28%)
Tryp_SPc 35..250 CDD:214473 68/250 (27%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 70/252 (28%)
Tryp_SPc 68..309 CDD:214473 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.