DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG11841

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:261 Identity:77/261 - (29%)
Similarity:116/261 - (44%) Gaps:51/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HGGGPKDIIVNGYPAYEGKAPYA--VGLRMNNGAVG---GGSVIGNNWVLTAAHCLTTDSVTIHY 86
            ||..|  :||:|.||...:.|:|  :|.|..|..:.   ||::|.|..|||||||..::    |.
  Fly    66 HGSRP--LIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSE----HG 124

  Fly    87 GSNRAWNGQLQHTVNKNN----------FFRHPGYPN-SAGHDIGLIRTP-YVSFTNLINKVSLP 139
            ..|....|:|:...:.::          ...|||:.| ...:|||:::.. .|.|....:...||
  Fly   125 EVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLP 189

  Fly   140 KFSQKGERFENWWCVACGWG-------------GMANGGLADWLQCMDVQVISNGECARSYGSVA 191
              ...||:.|::  :|.|||             .:...|..|  :|:. .|.:|.|....|  ..
  Fly   190 --FDDGEQHESF--IAIGWGQKKFAQKESKKLLKVQLQGYKD--RCVS-SVDANDELPNGY--EP 245

  Fly   192 STDMCTRATDGKSVCGGDSGGALVTHDNPI----QVGVITFASIGCKSG--PSGYTRVSDHLDWI 250
            .:.:|..:.|.|..|.|||||.::.:...:    .|..||.|.|.|.:.  ||.||||...|:||
  Fly   246 KSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310

  Fly   251 R 251
            :
  Fly   311 K 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 74/253 (29%)
Tryp_SPc 35..250 CDD:214473 72/250 (29%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 73/251 (29%)
Tryp_SPc 72..310 CDD:214473 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.