DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG10232

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:96/260 - (36%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NGYP-----AYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDS-VTIHYGSNRAWNGQ 95
            |.||     .||.:   .:....||.:   ||:|...:|||||||:..|. |.......|...|:
  Fly   266 NEYPWMAMLIYENR---RLSTMTNNCS---GSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGE 324

  Fly    96 LQHTVNKN----------------NFFR-HPGYPNSA--GHDIGLIR--TPYVSFTNLINKVSLP 139
            ...|.|.:                .:|. |..|.|::  ..||.|:|  || |.:|:.|..:.:|
  Fly   325 HDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTP-VRYTHEILPICVP 388

  Fly   140 KFSQKGERFENWWCVACGWGGMANGGLADWL----------QCMD-VQVISNGECARSYGSVAST 193
            |   ......|......|||...|...:..|          .|.| :....|           .:
  Fly   389 K---DPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENRYYCQDKISFFRN-----------ES 439

  Fly   194 DMCTRATDGKSVCGGDSGGAL-VTHDNPIQ-----VGVITFASIGC-KSGPSGYTRVSDHLDWIR 251
            .:|.....|:..|.|||||.| :|.:|..|     .|::::.|..| ...|..||:......||:
  Fly   440 QICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504

  Fly   252  251
              Fly   505  504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 67/260 (26%)
Tryp_SPc 35..250 CDD:214473 65/257 (25%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 67/260 (26%)
Tryp_SPc 260..503 CDD:214473 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.