DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and SPE

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:236 Identity:66/236 - (27%)
Similarity:92/236 - (38%) Gaps:48/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GGSVIGNNWVLTAAHCLTT-----DSVTIHYGSNRAW------------NGQ-------LQHTVN 101
            ||:::.:.:||||.|||.:     ....:|......|            |||       :...|.
  Fly   167 GGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVE 231

  Fly   102 KNNFFRHPGY-PNSAG--HDIGLIRTP-YVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMA 162
            |.  ..|..| |||..  :||.|:|.. .||:|:.:..:.||........|.::.....|||...
  Fly   232 KG--IIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTE 294

  Fly   163 NGGLADWLQCMDVQVISNGECARSYGS----VASTDMCTRATDGKSVCGGDSGGALVTHDNPIQV 223
            |...:.....:.|.|.:...|...|.|    :..:.||.....|...|||||||.|:.   ||..
  Fly   295 NMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMV---PIST 356

  Fly   224 G---VITFASI--------GCKSGPSGYTRVSDHLDWIREK 253
            |   |...|.:        |.|..|..|||....:|||::|
  Fly   357 GGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/234 (28%)
Tryp_SPc 35..250 CDD:214473 63/231 (27%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 65/234 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.