DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG16710

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:231 Identity:63/231 - (27%)
Similarity:89/231 - (38%) Gaps:53/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GSVIGNNWVLTAAHCL-------------------TTDSVTIHYGSNRAWNGQLQHTVNKNNFFR 107
            ||:|.|.:||||||||                   ..|.||...|........|:..|:.:...|
  Fly   143 GSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHR 207

  Fly   108 H-PGYPNSAGHDIGLIRTPY-VSFTNLINKV--------SLPKFSQKGERFENWWCVACGWGGMA 162
            | ..:.....:||.|:|..: |.:|..|..:        |.|.||       |......|||...
  Fly   208 HYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFS-------NHKLQIAGWGLSH 265

  Fly   163 NGGLADWLQCMDVQVISNG----ECARSYGSVA---STDMCTRATDGKSVCGGDSGGALVT---- 216
            ..|.::.|    :|...||    ||:.|..|:.   .|.:|.....|...|.|||||.|:.    
  Fly   266 KQGYSNVL----LQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMER 326

  Fly   217 --HDNPIQVGVITFASIGCKSGPSGYTRVSDHLDWI 250
              .:.....|:.::....|..||:.||:.|..::||
  Fly   327 GDEEFVYLAGITSYGYSQCGYGPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 63/231 (27%)
Tryp_SPc 35..250 CDD:214473 61/229 (27%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 61/229 (27%)
Tryp_SPc 106..362 CDD:238113 61/229 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.