DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG31219

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:310 Identity:78/310 - (25%)
Similarity:110/310 - (35%) Gaps:95/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLFVATVCAHRNRNR-----------TAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVG-- 60
            |||...:|.....||           :.:...|..:...||||.      .|:.|.:|...:.  
  Fly    59 LLFGQRICCPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPW------MAMLLYLNTTTLEIL 117

  Fly    61 ---GGSVIGNNWVLTAAHC-------LTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGY---- 111
               .||:|.|.:|||:|||       |:..||.:.           :|.:..:     |.|    
  Fly   118 PFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLG-----------EHDITYD-----PAYNPDC 166

  Fly   112 ---------PN--------------------SAGHDIGLIRTPY-VSFTNLINKVSLPK--FSQK 144
                     ||                    :..:||.|:|... |.:...|..:.:||  |..|
  Fly   167 RDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAK 231

  Fly   145 GERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYGSV---ASTDMCTRATDGKSVC 206
            .:      ....|||....|..:..|....::..|...||..:..:   .|..:|....||...|
  Fly   232 SK------LEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTC 290

  Fly   207 GGDSGGAL-VTHDNP--IQVGVITFASIGC-KSG-PSGYTRVSDHLDWIR 251
            .|||||.| ||.||.  ...|:.|:.|..| :.| |..|||.|..|.||:
  Fly   291 QGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 71/273 (26%)
Tryp_SPc 35..250 CDD:214473 69/270 (26%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 70/278 (25%)
Tryp_SPc 90..342 CDD:238113 72/279 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.