DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG5255

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:272 Identity:69/272 - (25%)
Similarity:116/272 - (42%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLLLLFVATVCA------HRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLR-MNNGAVG-G 61
            |:.|:||.::..:      ...:||           ||.|..|..|.|||.:.|: :.:||.. |
  Fly     5 LLPLVLFTSSAASQILYPPQYTKNR-----------IVGGEEAAAGLAPYQISLQGIGSGAHSCG 58

  Fly    62 GSVIGNNWVLTAAHC----------LTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGY-PNSA 115
            |::|...|::|||||          :.|.:..:|...::.:        ..:....|..| |...
  Fly    59 GAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYY--------YPDRIVEHSNYAPRKY 115

  Fly   116 GHDIGLIR-TPYVSFTNLINKVSLP-KFSQKGERFENWWCVACGWGGMANGG-LADWLQCMDVQV 177
            .:||.|:. ...:.|.|....|.|. :....|.|.     :..|||.::.|| :...||.::|..
  Fly   116 RNDIALLHLNESIVFDNATQPVELDHEALVPGSRL-----LLTGWGTLSLGGDVPARLQSLEVNY 175

  Fly   178 ISNGECARSYGSVASTD---MCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSGPSG 239
            :...:|..::.:....|   :||....|:..|.|||||.|| |:..: |.::.:.....|..|..
  Fly   176 VPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNGKL-VALVNWGLPCAKGYPDA 238

  Fly   240 YTRVSDHLDWIR 251
            :..:|.:.|:||
  Fly   239 HASISYYHDFIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 63/236 (27%)
Tryp_SPc 35..250 CDD:214473 61/233 (26%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 62/245 (25%)
Tryp_SPc 30..252 CDD:238113 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.