DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG4053

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:70/273 - (25%)
Similarity:115/273 - (42%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLLLLFVATVCAHRNR---------NRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLR-MNNGAV 59
            |:.|||...::...|.:         ||           ||.|..|.:|.|||.|.:: :....:
  Fly     7 LIWLLLLGTSIDVTRGKRLDNRKLLDNR-----------IVGGQEAEDGVAPYQVSIQTIWKTHI 60

  Fly    60 GGGSVIGNNWVLTAAHC---LTTDSVTIHYGSN-RAWNGQLQHTVNKNNFFRHPGY--PNSAGHD 118
            ..|.::...|:|||.||   .:.:.:.|..|:| |...||   |:..:....|..|  |....:|
  Fly    61 CSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQ---TLFPDEALVHCLYDIPYVYNND 122

  Fly   119 IGLIRTPYVSFTNLIN-KVSLPKFSQK----GERFENWWCVACGWGGMANG-GLADWLQCMDVQV 177
            |.||   :|:.:.:.| :..:.:.|::    |..     ....|||...:. ....:||.:::.:
  Fly   123 IALI---HVNESIIFNDRTQIVELSREQPPAGST-----VTLTGWGAPESSYPTVQYLQTLNLTI 179

  Fly   178 ISNGECARSYGSVASTD---MCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSG-PS 238
            |::.||...:......|   :||...:|:..|.|||||.|:....  .||::.:.. .|..| |.
  Fly   180 IAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGK--LVGLVNWGR-ACGVGMPD 241

  Fly   239 GYTRVSDHLDWIR 251
            .|.....:.||||
  Fly   242 MYANTVYYQDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 63/234 (27%)
Tryp_SPc 35..250 CDD:214473 60/231 (26%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 61/243 (25%)
Tryp_SPc 35..256 CDD:238113 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.