DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and modSP

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:224 Identity:52/224 - (23%)
Similarity:81/224 - (36%) Gaps:59/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KDIIVNGYPAYEGKAPYAVGLRMNNGAVG-----GGSVIGNNWVLTAAHCLTTDSVTIHYGSNRA 91
            |.....||.......|:.|||.:.:....     |||::..:.|:|||||:..:...:.|..:  
  Fly   366 KQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYD-- 428

  Fly    92 WNGQLQHTVNKNNFFRHPG--YPNSAGHDIGLI--------RT--------------PYVSFTNL 132
                 ...|....|:|:.|  .|.....|:.||        ||              |: ..:::
  Fly   429 -----TFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPF-ELSHV 487

  Fly   133 INK--VSLPKFSQKGERFENWWCVACGWGGMANGGLADW-------LQCMDVQVISNGECARSYG 188
            |..  |:...|::|....::           ..|..|.|       ||.:.....||..|.|:..
  Fly   488 IRPICVTFASFAEKESVTDD-----------VQGKFAGWNIENKHELQFVPAVSKSNSVCRRNLR 541

  Fly   189 SVASTDMCTRATDGKSV-CGGDSGGALVT 216
            .:.:...|. .|.|||: |.|||||...:
  Fly   542 DIQADKFCI-FTQGKSLACQGDSGGGFTS 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 51/221 (23%)
Tryp_SPc 35..250 CDD:214473 51/221 (23%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 51/219 (23%)
Tryp_SPc 371..591 CDD:304450 51/219 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.