DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG31326

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:113/253 - (44%) Gaps:41/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIVNGYPAYEGKAPYAVGL---RMNNGA--VGGGSVIGNNWVLTAAHC----------------L 77
            :|..|.....|:.|:.|.:   |.:||.  :.||::|..:.||:||||                |
  Fly   273 LIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSL 337

  Fly    78 TTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLIRTPY-VSFTNLINKVSLPKF 141
            ..:::.||  |:..:.|..|..:::|  |:...:..:   |:.|:|... |.:|:.|..:.|...
  Fly   338 GRNTLAIH--SDGEFRGVSQLIIHEN--FQFKQFTEA---DLALVRLDEPVRYTDYIVPICLWST 395

  Fly   142 SQKGERFENWWCVACGWGGMANG-GLADWLQCMDVQVISNGECARS--YGSVASTDMCTRATDGK 203
            |.:.:..:.......|||....| |..:..:..|:.::|...||..  :..|..:.:|.:.| |.
  Fly   396 SNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKT-GA 459

  Fly   204 SVCGGDSGGALVTHDNPIQV-------GVITFASIGCK-SGPSGYTRVSDHLDWIREK 253
            ..|..|.||.|:..:..:.|       |||......|: |.||.:|.|:.|::|:|:|
  Fly   460 GPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQK 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 64/250 (26%)
Tryp_SPc 35..250 CDD:214473 62/247 (25%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 63/247 (26%)
Tryp_SPc 277..514 CDD:214473 61/244 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.