DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG13318

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:298 Identity:80/298 - (26%)
Similarity:114/298 - (38%) Gaps:81/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGGPKDI-IVN--GYP--------------------------------------AYEGKAPY--- 48
            |.|..|| |||  |||                                      |..|:|.:   
  Fly   110 GSGQIDIRIVNNGGYPTVPTTSSTLTCSYGLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAY 174

  Fly    49 ---AVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQL------QHTVNKNN 104
               |..|...:..:|||::|....||||||.:....:|........|:...      ...|..:|
  Fly   175 PWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISN 239

  Fly   105 FFRHPGY-PNSAGHDIGLIR--TPYVSFT--NLINKVSLPKFSQKGERFENWWCVACGWGGM--- 161
            .:.:|.: ||:..:|:.:::  || ||.|  :.:..|.||..|..|:|     |...|||..   
  Fly   240 VYVNPSFNPNNLQNDVAILKLSTP-VSLTSKSTVGTVCLPTTSFVGQR-----CWVAGWGKNDFG 298

  Fly   162 ANGGLADWLQCMDVQVISNGEC-----ARSYGS---VASTD-MCTRATDGKSVCGGDSGGALVTH 217
            |.|......:.:||.:|.|..|     |...||   ::.|. :|.....||..|.||.|..||..
  Fly   299 ATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCT 363

  Fly   218 DNPI--QVGVITFASIGCKSG--PSGYTRVSDHLDWIR 251
            .|.:  .||::.: .|||...  |..|..|..:|.||:
  Fly   364 SNGVWYVVGLVAW-GIGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 76/290 (26%)
Tryp_SPc 35..250 CDD:214473 74/287 (26%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 68/239 (28%)
Tryp_SPc 169..399 CDD:214473 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.