DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon74E

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:279 Identity:93/279 - (33%)
Similarity:135/279 - (48%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKKLVLLLLFV---ATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNG----A 58
            :|..||.||:.|   :..|....      ||.|.:  |..|..|...:.||.|||.:...    .
  Fly     3 ISTILVFLLILVQGRSISCLDMG------HGIGGR--IAGGELARANQFPYQVGLSIEEPNDMYC 59

  Fly    59 VGGGSVIGNNWVLTAAHCLTTDSVTIHY---GSNRAWNGQLQHTVNKNNFFRHPGYP-NSAGHDI 119
            ..|.|:|.:.::||||||: ..:|.|.|   |..|....||..:.|. ....||.:. .|..:||
  Fly    60 WCGASLISDRYLLTAAHCV-EKAVAITYYLGGVLRLAPRQLIRSTNP-EVHLHPDWNCQSLENDI 122

  Fly   120 GLIRTPY-VSFTNLINKVSLPKFSQKGERFENWWCVACGWGGM--ANGGLADWLQCMDVQVISNG 181
            .|:|.|. ....:.|..:.||..|.....::....:|.|||.|  .:..::|.|:.:...|.||.
  Fly   123 ALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNE 187

  Fly   182 ECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQ-----VGVITFA-SIGCKSG-PSG 239
            :|..||.::..|::|...|.|||.|.|||||.|| :.:|:|     :||.::. ..||..| ||.
  Fly   188 DCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLV-YSDPVQNADILIGVTSYGKKSGCTKGYPSV 251

  Fly   240 YTRVSDHLDWIREKSGIAY 258
            :||::.:||||.|.||:.|
  Fly   252 FTRITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 79/235 (34%)
Tryp_SPc 35..250 CDD:214473 77/232 (33%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.