DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG18179

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:267 Identity:168/267 - (62%)
Similarity:197/267 - (73%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLVLLLLFV--ATVCAHRNRNRTA-----HHGGGPKDIIVNGYPAYEGKAPYAVGLRM-----NN 56
            ||.||.|.|  |.|.|....|||:     ....|.:..|||||||.||||||.|||.:     |:
  Fly     2 KLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNS 66

  Fly    57 GAVGGGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGL 121
            .|||.|::|.::|:||||||||||.|.||||||..|||..:.:|.::||..||.:|...|.||||
  Fly    67 AAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGL 131

  Fly   122 IRTPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECARS 186
            ||||.|.||:|||||:||.||::.:||.:.||||||||||.||.|||||||||||:|||.||.:|
  Fly   132 IRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQS 196

  Fly   187 YGSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSGPSGYTRVSDHLDWIR 251
            ||:|||||||||.|||||.|||||||.||||||...||||||.|:.|.|||||||||:|:|.|||
  Fly   197 YGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVDCHSGPSGYTRVTDYLGWIR 261

  Fly   252 EKSGIAY 258
            :.:||:|
  Fly   262 DNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 152/222 (68%)
Tryp_SPc 35..250 CDD:214473 149/219 (68%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 149/220 (68%)
Tryp_SPc 40..263 CDD:238113 152/222 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.