DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:269 Identity:128/269 - (47%)
Similarity:164/269 - (60%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLLLLFVATVCAHRNRNRTAHHGGGPKDI---------IVNGYPAYEGKAPYAVGLRMNNGAVG 60
            |.:|.|.||:..|:.:   ..|    |||:         |.|||||.||||||.|||..:.|...
  Fly     5 LTILALAVASASAYES---VVH----PKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGWWC 62

  Fly    61 GGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLIRTP 125
            |||:|.|.|||||.||:..|:||:::|:....|.|..|.|...||..|    .||  ||.|||.|
  Fly    63 GGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTHWVGSGNFITH----GSA--DIALIRIP 121

  Fly   126 YVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGG-LADWLQCMDVQVISNGECARSY-- 187
            :|.|.:::|||.||.::.:...:..||.|||||||..:|. |.|:|||:|:|:|.|.|||..|  
  Fly   122 HVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYGT 186

  Fly   188 GSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFAS-IGCKSG-PSGYTRVSDHLDWI 250
            |:|....:|.|..|||..|||||||.|||||....|||..:.| .||::| |:|:.||:.|||||
  Fly   187 GTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWI 251

  Fly   251 REKSGIAYY 259
            |:.:|||||
  Fly   252 RDHTGIAYY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 113/222 (51%)
Tryp_SPc 35..250 CDD:214473 110/219 (50%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 110/220 (50%)
Tryp_SPc 37..254 CDD:238113 113/222 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470704
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.