DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG33460

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:223 Identity:49/223 - (21%)
Similarity:93/223 - (41%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGY 111
            |:...|..:......|::|.:.::||||.|:..::|.:..|....:..:|......:.|..:..:
  Fly    44 PWTALLHTDGSIFCAGTLITDVFILTAASCIRPNAVKVRLGEFGRYPNELPEDHLVHYFLMYRLF 108

  Fly   112 PN-SAGHDIGLIR-TPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMD 174
            .| |..::|||:: |..|..|:.|..|.: ..:.:.::......:...|...:|..|...|:.:.
  Fly   109 NNESLANNIGLLKLTKRVQITDYIMPVCI-VLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIV 172

  Fly   175 VQ----VISNGE-----CARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHD------NPIQVG 224
            :|    :.:|.:     ||...|::.|             |.|.:|.||:.:.      ..||.|
  Fly   173 IQSKPKMCTNLDLYTQFCAGHQGNLRS-------------CDGLTGSALIQNSRYMNKYRHIQFG 224

  Fly   225 VITFASIGCKSGPSGYTRVSDHLDWIRE 252
            :.|...:.|:.. .|||.|.....||::
  Fly   225 IATVNDMDCEES-QGYTDVLKFYWWIQD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 49/223 (22%)
Tryp_SPc 35..250 CDD:214473 47/219 (21%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 49/223 (22%)
Tryp_SPc 44..249 CDD:214473 47/219 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.