DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG33465

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:234 Identity:61/234 - (26%)
Similarity:98/234 - (41%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 APYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDS-VTIHYG-------SNRAWNGQ------- 95
            ||:...:..||..:..|:::...:|||||.|::.|| :.:.:|       :::.:|.:       
  Fly    45 APWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVA 109

  Fly    96 LQHTVNKNNFFRHPGYPNSAGHDIGLIR-----TPYVSFTNLINKVSLPKFSQKGERFENWWCVA 155
            |||    :||     .||:..:||||:|     |.|.....:...:.....|...||||.:    
  Fly   110 LQH----SNF-----RPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGF---- 161

  Fly   156 CGWGGMANGGLADWLQCMDVQVISNGECARSYGS---VASTDMCTRATDGKSVCGGDSGGALV-- 215
             ||........:...|.:.:......||.|: |.   :.....|....| :|.|..:||..|.  
  Fly   162 -GWQQQGTEASSQVRQTVYLSQKKPFECHRN-GQLLPINEGQFCAGNRD-RSFCRSNSGSPLTAD 223

  Fly   216 ----THDNPIQVGVITFASIGCKSGPSGYTRVSDHLDWI 250
                ..:..:|||::::.|..| |..|.||.|....|||
  Fly   224 FTYGVKNITVQVGLVSYGSELC-SPTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 61/234 (26%)
Tryp_SPc 35..250 CDD:214473 59/232 (25%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/233 (26%)
Tryp_SPc 46..261 CDD:214473 58/231 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.