DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG10472

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:246 Identity:86/246 - (34%)
Similarity:125/246 - (50%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PKDIIVNGYPAYEGKAPYAVGLRM--NNGAVG-GGSVIGNNWVLTAAHCLTTDSVT--------I 84
            |...|..|..|...:.||.|||.:  ..||.. ||::|.:.|::|||||  |||:|        .
  Fly    43 PSGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHC--TDSLTTGVDVYLGA 105

  Fly    85 HYGSNRAWNGQLQHTVNKNNFFRHPGY-PNSAGHDIGLIRTPY-VSFTNLINKVSLPKFSQKGER 147
            |..:|....||....|...|...|..: ..:..:||.||:.|. :.|...|....||..|.....
  Fly   106 HDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYST 170

  Fly   148 FENWWCVACGWGGMANG--GLADWLQCMDVQVISNGECARSY-GSVASTDMCTRATDGKSVCGGD 209
            :.....:|.|||.:::.  |..|.||...|.:::|..|:..| |.||::::|.:.|.|.|.|.||
  Fly   171 YGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGD 235

  Fly   210 SGGALVTHD--NPIQVGVITFA-SIGCKSG-PSGYTRVSDHLDWIREKSGI 256
            |||.||..|  |.: :|..:|. ::||:.| |..:||::.:||||.||||:
  Fly   236 SGGPLVLDDGSNTL-IGATSFGIALGCEVGWPGVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 81/237 (34%)
Tryp_SPc 35..250 CDD:214473 79/234 (34%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 79/235 (34%)
Tryp_SPc 47..282 CDD:238113 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.