DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:277 Identity:116/277 - (41%)
Similarity:157/277 - (56%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLLLFVATVCAHRNRNRTAHHGGGP---KDI----------IVNGYPAYEGKAPYAVGLRMNNG 57
            ||||..:|:..|...          |   ||:          |..||||||||.||.|||..:..
  Fly     6 VLLLGVIASATAFEK----------PVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKN 60

  Fly    58 AVG---GGSVIGNNWVLTAAHCLTTD---SVTIHYGSNRAWNGQLQHT--VNKNNFFRHPGYPNS 114
            ..|   |||:|||.||:||.||  ||   ||||:||:  .|..|.|:|  |.:::|..|      
  Fly    61 GGGTWCGGSIIGNTWVMTAKHC--TDGMESVTIYYGA--LWRLQAQYTHWVGRSDFIEH------ 115

  Fly   115 AGHDIGLIRTPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMAN-GGLADWLQCMDVQVI 178
            ...||.|||||:|.|.:|:|||.||::..:...::.||.:..|||..:: ||::::|.|:|||:.
  Fly   116 GSGDISLIRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIG 180

  Fly   179 SNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITF-ASIGCKS-GPSGYT 241
            .|..|...|||.:...:|....:.|..|.|||||.||.||...|||:::| :|.||.| ||.|..
  Fly   181 ENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMV 245

  Fly   242 RVSDHLDWIREKSGIAY 258
            ||:.:|||||:.:||:|
  Fly   246 RVTSYLDWIRDNTGISY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 104/228 (46%)
Tryp_SPc 35..250 CDD:214473 101/225 (45%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 101/226 (45%)
Tryp_SPc 41..257 CDD:238113 103/225 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.