DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:235 Identity:110/235 - (46%)
Similarity:139/235 - (59%) Gaps:23/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVG----GGSVIGNNWVLTAAHCLTTDS-VTIHYGSNRAWNG 94
            |.|||||||||.||.|.||.:||..|    |||:||:.||||||||....| |||.||:  .|..
  Fly    37 ITNGYPAYEGKVPYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGA--VWRQ 99

  Fly    95 QLQHTVNKNNFFRHPGYPNSAGH-DIGLIRTPYVSFTNLINKVSLPKFSQKGERFENWWCVACGW 158
            |.|        |.|  |.....| ||.|||||:|.|.:|:|||.||::..:...|..||.:..||
  Fly   100 QPQ--------FTH--YDTGNLHNDIALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGW 154

  Fly   159 GGMA-NGGLADWLQCMDVQVISNGECARSYGS--VASTDMCTRATDGKSVCGGDSGGALVTHDNP 220
            |..: :.|:.|:|.|:|:|:..|..|...|||  :.|..:|....:.|..|.|||||.||.||..
  Fly   155 GSSSDSSGMTDYLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGN 219

  Fly   221 IQVGVITFAS-IGCKS-GPSGYTRVSDHLDWIREKSGIAY 258
            .|||:::|.| .||.| .|.|.|||:.:|||||:.:||:|
  Fly   220 RQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWIRDHTGISY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 107/228 (47%)
Tryp_SPc 35..250 CDD:214473 104/225 (46%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 104/225 (46%)
Tryp_SPc 37..254 CDD:238113 107/228 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.