DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:275 Identity:109/275 - (39%)
Similarity:155/275 - (56%) Gaps:26/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKLVLLLLFVATVC------AHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVG- 60
            |.|::|.|.||...      .||:|........|.:  |..|..|..|:.||.|||.:...|:. 
  Fly     2 KFLIILALAVAASAFPEPELRHRSREMPVVGDIGGR--ITGGSNAAVGQFPYQVGLSLKLSALSS 64

  Fly    61 ---GGSVIGNNWVLTAAHCLTTD---SVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAG--H 117
               |||:||:.||||||||  ||   |||::.|:....:.::.|||:.::...|.|: |||.  :
  Fly    65 AWCGGSLIGSTWVLTAAHC--TDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGW-NSANLRN 126

  Fly   118 DIGLIRTPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMA--NGGLADWLQCMDVQVISN 180
            ||.||:.|..|.::.|:.|.||..|.....|.....||.|||..:  :.|:|..||.:|:.||:|
  Fly   127 DISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITN 191

  Fly   181 GECARSYGSVASTD--MCTRATDGKSVCGGDSGGALVTHDNPIQVGVITF-ASIGCKSG-PSGYT 241
            .:||::||:...||  :|...||.||.|.|||||.||...:..|:|:.:| ||.||:.| |:.:|
  Fly   192 TKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFT 256

  Fly   242 RVSDHLDWIREKSGI 256
            ||:.:||||:..:||
  Fly   257 RVTSYLDWIKTNTGI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 97/232 (42%)
Tryp_SPc 35..250 CDD:214473 95/229 (41%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 95/232 (41%)
Tryp_SPc 38..268 CDD:238113 97/232 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470881
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.