DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG30283

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:270 Identity:72/270 - (26%)
Similarity:112/270 - (41%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLLLLFVATVCAHRNRNRTAHHGGGPKDI----IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVI 65
            :|:||...:.|...........|..|...|    |:.|:.|....||:...:....|...||::|
  Fly     9 VVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLI 73

  Fly    66 GNNWVLTAAHCLTTDSVTIHYGSNRAWNGQLQHTVNKNNF-----FRHPGYPNSAGHDIGLIR-T 124
            .|.:|||:|||:....:.:..       |.|:.......|     |.|..|.... ||:.|:| .
  Fly    74 TNRFVLTSAHCIANGELKVRL-------GVLEREAEAQKFAVDAMFVHTDYYFDQ-HDLALLRLA 130

  Fly   125 PYVSFTNLINKVSL---PKFSQKGE---RFENWWCVACGWGGMANGGLADWLQCMDVQVISNGEC 183
            ..|.:::.|:.:.|   |......|   :|..:     |||...:...:..||...:..:...||
  Fly   131 KRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY-----GWGKTESRSSSRMLQKTSLFNLHRSEC 190

  Fly   184 ARSY--GSVASTDMCTRATDGKSVCGGDSGG---ALVTHDN---PIQVGVITFASIGCKSGPSGY 240
            |:.|  ..:....:|..:.:. :.|.|||||   |:||:|:   ..|.||.:|....| |..:.:
  Fly   191 AKQYPHQQINRNHICAESANA-NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADC-SKATVF 253

  Fly   241 TRVSDHLDWI 250
            |.|..|||||
  Fly   254 TNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/236 (28%)
Tryp_SPc 35..250 CDD:214473 63/234 (27%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 63/235 (27%)
Tryp_SPc 43..266 CDD:238113 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.