DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG10764

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:270 Identity:70/270 - (25%)
Similarity:118/270 - (43%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKKLVLLLLFVATVCAHRNRNRTAHH-------GGGPKDIIVNGYPAYEGKAPYAVGLRMNNGA 58
            |...:.:.||.:.|:|...|.    |.       |...:..|..|..|.|..:.:...:..::..
  Fly     1 MRSLVSVALLSLLTLCVTENE----HFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDF 61

  Fly    59 VGGGSVIGNNWVLTAAHCLTTD-SVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLI 122
            ..||::|...:||:|||||... .:.:..|:.........||| .|.|..|....:...:||||:
  Fly    62 QCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTV-INVFVHHDFIASEYRNDIGLL 125

  Fly   123 R-TPYVSFTNLINKVSL---PKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGEC 183
            : :..:.:|..:..:.:   |......|:.:.:  .|.|||. .||.|:..||.:.:..:...||
  Fly   126 QLSESIVYTVRVQPICIFLDPALKGSVEKLKTF--RALGWGN-RNGKLSIMLQTIYLLHLKRNEC 187

  Fly   184 ARSYG-SVASTDMCTRATDGKSVCGGDSGGALVTH-------DNPIQVGVITFASIGCKSGPSGY 240
            .|... ::.|..:|....:| ..|.|||||.|.|:       ...:|:|:::|....|: |...|
  Fly   188 KRKLNFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECR-GVGVY 250

  Fly   241 TRVSDHLDWI 250
            |.|:.::|||
  Fly   251 TDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 62/229 (27%)
Tryp_SPc 35..250 CDD:214473 60/227 (26%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 60/228 (26%)
Tryp_SPc 38..263 CDD:238113 62/229 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.