DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and PRSS41

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:274 Identity:67/274 - (24%)
Similarity:110/274 - (40%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHC 76
            ::..|.||..:.          ::..|..:..|:.|:...||:......|||::...|||:||||
Human    58 LSEACGHREIHA----------LVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHC 112

  Fly    77 LTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGY------------PNSAG---HDIGLIR-TP 125
            ...     ||..:. |..||....::...:....|            |::.|   :||.|:| ..
Human   113 FQK-----HYYPSE-WTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLAS 171

  Fly   126 YVSFTNLINKVSLP----KFSQKGERFENWWCVACGWGGMANGGL----ADWLQCMDVQVISNGE 182
            .|::...|..:.:.    .|..:.:      |...|||.::..|.    ...|:...|.:::|..
Human   172 SVTYNAYIQPICIESSTFNFVHRPD------CWVTGWGLISPSGTPLPPPYNLREAQVTILNNTR 230

  Fly   183 CARSYGSVASTDM------CTRATDGK-SVCGGDSGGALVTHDNPI--QVGVITFA-SIGCKSGP 237
            |...:...:|..|      |..|.||. ..|.|||||.||...:.:  |||::::. ..|..:.|
Human   231 CNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRP 295

  Fly   238 SGYTRVSDHLDWIR 251
            ..||.:|.:..|||
Human   296 GVYTNISVYFHWIR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 64/251 (25%)
Tryp_SPc 35..250 CDD:214473 61/248 (25%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.