DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and scaf

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:226 Identity:62/226 - (27%)
Similarity:94/226 - (41%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPY-AVGLRMNNGA-VGGGSVIGNNWVLTAA 74
            :|.|||.||: ||  ...|.||:..|     ..:.|: |:.||.::.. :.||::||:.:||::|
  Fly   408 LAGVCATRNK-RT--KPTGVKDLDAN-----FAEIPWQAMILRESSKTLICGGAIIGDQFVLSSA 464

  Fly    75 HC---LTTDSVTIHYG------SNRAWNGQLQ--HTVNKNNFFRHPGY-PNSAGHDIGLIRTP-Y 126
            .|   |....:.:..|      :|.....||.  .||:.     ||.| |::..||:.:||.. .
  Fly   465 SCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDV-----HPDYDPSTNSHDLAIIRLERR 524

  Fly   127 VSFTNLINKVSL----PKFSQKGERFENWWCVACGWGGMA-----NGGLADWLQCMDVQVISNGE 182
            :.|.:.|..:.:    ||.|::        |...|||..|     .|.|   :...|....:..|
  Fly   525 LEFASHIQPICISDEDPKDSEQ--------CFTSGWGKQALSIHEEGAL---MHVTDTLPQARSE 578

  Fly   183 CARSYGSVAST---DMCTRATDGKSVCGGDS 210
            |:....||.|.   |.|.........||..|
  Fly   579 CSADSSSVCSATKFDSCQFDVGSALACGSGS 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 51/203 (25%)
Tryp_SPc 35..250 CDD:214473 51/203 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 51/203 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.