DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG9377

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:272 Identity:61/272 - (22%)
Similarity:98/272 - (36%) Gaps:69/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GYPAYE---GKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTT---DSVTIHYGSNRAWNGQL 96
            ||...|   |:.|:.|.:..::..:..|::|....|:|.|||:..   :.|.:..|.   |:..:
  Fly   101 GYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGE---WDAAV 162

  Fly    97 --------QHTVNKNNFFRHPGYPN-SAGHDIGLI----RTPYVSFTNLINKVSLP------KFS 142
                    |.:|.:.  ..||.|.. ...|:|.::    ..|:....| :..:.||      .:|
  Fly   163 ELEPQPHQQRSVVET--LVHPNYTQMPLAHNIAILLVDKEKPFQLAPN-VQPICLPPPRIMYNYS 224

  Fly   143 QKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGEC---------ARSYGSVASTD--MC 196
            |         |...||.....|..|...:...:.|:...:|         .|.:   |..|  :|
  Fly   225 Q---------CYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRH---AHNDSLLC 277

  Fly   197 TRATDGKSVCGGDSGGA------LVTHDNPIQVGVITFASIGCKSGPS--G-YTRVSDHLDWI-- 250
            .....|..|||.....|      |..||:...:..:...:..| .||.  | ||.|..:..||  
  Fly   278 AGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARC-DGPQLLGIYTNVKLYRQWIDL 341

  Fly   251 --REKS-GIAYY 259
              ||:: .|.:|
  Fly   342 KLRERNLDIRHY 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 58/263 (22%)
Tryp_SPc 35..250 CDD:214473 55/256 (21%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 54/253 (21%)
Tryp_SPc 105..339 CDD:214473 53/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.