DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and PRSS48

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:238 Identity:67/238 - (28%)
Similarity:107/238 - (44%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL----TTDSVTIHYGSNRAWNGQ 95
            :|.|..|..|:.|:.|.|..::..:.|||::....:||||||:    ||.|.|:..||....:.:
Human    51 VVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFSYTVWLGSITVGDSR 115

  Fly    96 LQHTVNKNNFFRHPGYPNSAGHDIGLIR-TPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWG 159
            .:.....:....||.|.::.. |:.|:: :..|:||:.|..:.||..::  :.....:|...|||
Human   116 KRVKYYVSKIVIHPKYQDTTA-DVALLKLSSQVTFTSAILPICLPSVTK--QLAIPPFCWVTGWG 177

  Fly   160 GMANGGLADW---LQCMDVQVISNGECARSYGSVA-----------STDMCTRATDG-KSVCGGD 209
            .:......|:   ||..:|.:|....|.:.|..:.           ...:|...|.. |..|.||
Human   178 KVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGD 242

  Fly   210 SGGALVTHDNP--IQVGVITFASIGCKSGPSGYTRVSDHLDWI 250
            |||.|..|.:.  ||.||:::.....||.|..||.|..:..||
Human   243 SGGPLSCHIDGVWIQTGVVSWGLECGKSLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 67/238 (28%)
Tryp_SPc 35..250 CDD:214473 65/236 (28%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 65/236 (28%)
Tryp_SPc 51..288 CDD:238113 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.