DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:267 Identity:130/267 - (48%)
Similarity:170/267 - (63%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKLVLLLLFVATVCAHRNRNRTAHHGGGPKDI-----IVNGYPAYEGKAPYAVGLRM--NNGAVG 60
            |..|:|.|.:|.|.|...:.  .|....|||.     ||||||||||||||.|||..  |.|...
  Fly     2 KVFVVLALALAAVSAETVQQ--VHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWC 64

  Fly    61 GGSVIGNNWVLTAAHCLT-TDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLIRT 124
            |||:|.::||||||||.. ...|||:||:....|.|..|||...:|.::..:||..|:||.||||
  Fly    65 GGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIRT 129

  Fly   125 PYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYGS 189
            |:|.|.:::|||.||.|:.:...::|:|.||||||....|...||::|:|:|:|||.||:|:||:
  Fly   130 PHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGT 194

  Fly   190 VASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFAS-IGCKSG-PSGYTRVSDHLDWIRE 252
            .....:|...:.|||.|.|||||.||.||....|||.::.| .||.:| |||:|||::.|||||:
  Fly   195 QPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRD 259

  Fly   253 KSGIAYY 259
            .||:|||
  Fly   260 NSGVAYY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 114/222 (51%)
Tryp_SPc 35..250 CDD:214473 111/219 (51%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 111/220 (50%)
Tryp_SPc 37..260 CDD:238113 114/222 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.