DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Hayan

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:262 Identity:71/262 - (27%)
Similarity:117/262 - (44%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGGPKDI-IVNGYPAYEGKAPYAVGLRMNN-GAVG---GGSVIGNNWVLTAAHCLTTDSVT---I 84
            ||.|..: |::|.....|..|:...:..|: |:..   |||:|.:.:|||||||:.:|..|   :
  Fly   377 GGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFV 441

  Fly    85 HYGSNRAWNGQLQH-TVNKNNFFRHPGYPNSAG-HDIGLIR-TPYVSFTNLINKVSLPKFSQKGE 146
            ..|:....|.:..: .:|..:...||.|..|:. :||.::: ......:::|....|  ::.:.:
  Fly   442 RLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACL--YTDRSD 504

  Fly   147 RFENWWCVACGWGGM--ANGGLADWLQCMDVQVISNGECARSY------------GSVASTDMCT 197
            ...|:.....|||.|  .|..::..|....:.::...||..|:            |.:||.....
  Fly   505 PPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAA 569

  Fly   198 RATDGKSVCGGDSGGALVTHDNPIQ-----VGVITFASIGCKSGPSG-YTRVSDHLDWIREKSGI 256
            .....|..|.|||||.|:...:.:.     ||||: :..||.:...| |||||..||:|   .||
  Fly   570 DKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVIS-SGFGCATKTPGLYTRVSSFLDYI---EGI 630

  Fly   257 AY 258
            .:
  Fly   631 VW 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 66/247 (27%)
Tryp_SPc 35..250 CDD:214473 65/244 (27%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 65/245 (27%)
Tryp_SPc 385..630 CDD:238113 66/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.