DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and sphe

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:266 Identity:65/266 - (24%)
Similarity:108/266 - (40%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKKLVLLLLFVAT---VCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGG 62
            |..:||:|.|...|   :|..:.|             |:.|..|......:...||::|..|.||
  Fly     2 MQPRLVILGLIGLTAVGMCHAQGR-------------IMGGEDADATATTFTASLRVDNAHVCGG 53

  Fly    63 SVIGNNWVLTAAHCLTTDSVTI-------HYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIG 120
            |::....:||.|||:..|...|       ..||...:.|  ...||..:...||.|.|...:...
  Fly    54 SILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAG--GKIVNVESVAVHPDYYNLNNNLAV 116

  Fly   121 LIRTPYVSFTNLINKVSLPKFSQKGERF--ENWWCVACGWGGMANGGLADWLQCMDVQVISNGEC 183
            :..:..:::|:.|..:.|   ...||..  |....:..|||..::|..:..::.:.::|.....|
  Fly   117 ITLSSELTYTDRITAIPL---VASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATC 178

  Fly   184 ARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSG-PSGYTRVSDHL 247
            ..:|........|......:..|.||.||..: :.|.: :|:..|....|.|. |..:.|:|.:.
  Fly   179 LDAYSDHDEQSFCLAHELKEGTCHGDGGGGAI-YGNTL-IGLTNFVVGACGSRYPDVFVRLSSYA 241

  Fly   248 DWIREK 253
            |||:|:
  Fly   242 DWIQEQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 56/227 (25%)
Tryp_SPc 35..250 CDD:214473 54/224 (24%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/211 (25%)
Tryp_SPc 42..244 CDD:214473 51/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.