DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG8952

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:284 Identity:89/284 - (31%)
Similarity:137/284 - (48%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKLVLLLLFVATVCAHRNRNRTAHHGGGPKD-----------IIVNGYPAYEGKAPYAVGLRMN- 55
            :.|:|:||...:|.            |.|.|           .||:|..|..|:.|:.|.|:.: 
  Fly     7 RSLMLVLLAAISVV------------GQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDA 59

  Fly    56 -NGAVGGGSVIGNNWVLTAAHCLT-TDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHD 118
             :..:.|||:|.:.||||||||.. ..|:.:.:|:...:|....: :..||...||.|.:...:|
  Fly    60 WDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALN-MTSNNIIIHPDYNDKLNND 123

  Fly   119 IGLIRTPY-VSFTNLINKVSLPKFSQKGERFENWWCVA--CGWGGMANGGL--ADWLQCMDVQVI 178
            :.||:.|. ::|:..|..:.|  ..|.|:..:....||  .|:|...:..|  ::.|....|::|
  Fly   124 VSLIQLPEPLTFSANIQAIQL--VGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEII 186

  Fly   179 SNGECARSYGS--VASTDMCTRATDGK--SVCGGDSGGALVTHDNPI----QVGVITF-ASIGCK 234
            .|.:|...||.  |..:.||.:..||.  |.|.|||||.|:.::..|    |:|:.:| |...|.
  Fly   187 DNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCT 251

  Fly   235 SG-PSGYTRVSDHLDWIREKSGIA 257
            .. ||||.|||..|.:|.:|:|||
  Fly   252 YRLPSGYARVSSFLGFIADKTGIA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 77/235 (33%)
Tryp_SPc 35..250 CDD:214473 76/232 (33%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 76/233 (33%)
Tryp_SPc 38..271 CDD:238113 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.