DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and ctrb.1

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:228 Identity:72/228 - (31%)
Similarity:109/228 - (47%) Gaps:17/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNG-AVGGGSVIGNNWVLTAAHCLTTDSVTIHYGS-NRAWNGQLQ 97
            ||||..|.....|:.|.|:.:.| ...|||:|..|||:|||||....|..:..|. :|:.|.:..
Zfish    34 IVNGEEARPHSWPWQVSLQDSTGFHFCGGSLINENWVVTAAHCNVRTSHRVILGEHDRSSNAEAI 98

  Fly    98 HTVNKNNFFRHPGYPN-SAGHDIGLIR--TPYVSFTNLINKVSLPKFSQKGERFENWW-CVACGW 158
            .|:......:||.|.: :..:||.||:  ||    ..:...||....::..:.|.... ||..||
Zfish    99 QTIAVGKSIKHPNYNSFTINNDILLIKLATP----AKINTHVSPVCLAETNDNFPGGMKCVTSGW 159

  Fly   159 GGMANGGLAD---WLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNP 220
             |:......|   .||...:.:::|.:|.|.:|:..:..|......|.|.|.|||||.||..:|.
Zfish   160 -GLTRYNAPDTPALLQQAALPLLTNDDCKRYWGTNITDLMICAGASGVSSCMGDSGGPLVCENNR 223

  Fly   221 I--QVGVITFASIGCK-SGPSGYTRVSDHLDWI 250
            :  .||::::.|..|. |.|:.|.||:....|:
Zfish   224 VWTLVGIVSWGSSTCSTSTPAVYARVTKLRAWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 72/228 (32%)
Tryp_SPc 35..250 CDD:214473 71/226 (31%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 71/226 (31%)
Tryp_SPc 34..259 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.