DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG31269

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:274 Identity:79/274 - (28%)
Similarity:123/274 - (44%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKKLVLLLLFVA---TVCAHRNRNRTAHHGGGPKD-IIVNGYPAYEGKAPYAVGLRMNNGAVG- 60
            ||..::|:||.::   ::.|.|.:..:. .|...|| .|:.|..|.:|.|||.:.|:..:||.. 
  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNST-DGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSC 64

  Fly    61 GGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQLQHTVNKNN------FFR----HPGYPNSA 115
            ||::|...:|||||||:....:        .|...:..| ||.|      |.:    |..|.|..
  Fly    65 GGAIINETFVLTAAHCVENAFI--------PWLVVVTGT-NKYNQPGGRYFLKAIHIHCNYDNPE 120

  Fly   116 GH-DIGLIR-TPYVSFTNLINKVSLPKF-SQKGERFENWWCVACGWGGMANGGLADW-LQCMDVQ 176
            .| ||.|:. ...:::......:.||.. .|.|:.     .:..|||.....|.:.. ||.:.:|
  Fly   121 MHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDE-----VILTGWGSTVLWGTSPIDLQVLYLQ 180

  Fly   177 VISNGECARSYGSVASTD---MCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSG-P 237
            .:.:.||.....:....|   :||.:..|:..|.|||||.||:  |...||::.: ...|.:| |
  Fly   181 YVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS--NGYLVGLVNW-GWPCATGVP 242

  Fly   238 SGYTRVSDHLDWIR 251
            ..:..|..:.||||
  Fly   243 DVHASVYFYRDWIR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 69/236 (29%)
Tryp_SPc 35..250 CDD:214473 66/233 (28%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/234 (28%)
Tryp_SPc 38..258 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.