DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG31205

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:288 Identity:71/288 - (24%)
Similarity:112/288 - (38%) Gaps:55/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKKLVLLLLFVATV------------CAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYA---VG 51
            |:||:..||.:.|:            |...|..:.      ..|.|:    |...:.|:.   ||
  Fly     3 SRKLLTFLLTITTLHPTIQAASVGQECGIFNEKQY------NSDNII----AEPTEHPWVVRIVG 57

  Fly    52 LRM--NNGAVGGGSVIGNNWVLTAAHCLTTD-SVTIH---YGSNRAWNGQLQHTVNKNNFFRHPG 110
            :..  :|..:..|.:|.:..|:|||||::.| |.:|:   :|.:.:.|..|...|..     ||.
  Fly    58 VTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVTV-----HPD 117

  Fly   111 Y-PNSAGHDIGLIR-TPYVSFTNLINKVSLPKFSQ--KGERFENWWCVACGWGGMANGGLADWLQ 171
            | |....:|:.:|. |..|.|::|:..:.||..|:  .|....|...:..|..|.:........|
  Fly   118 YSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQ 182

  Fly   172 CMDVQV------ISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALV-THDNPIQVGVITFA 229
            .:|.::      |.:.||...........:|     |.:.....||.||. ....|.|..::..|
  Fly   183 RLDKRIKMTYTKIDSKECHEKQARFPEELIC-----GHTERSPLSGSALTEASGTPRQFHLLGIA 242

  Fly   230 SIGCKSGP---SGYTRVSDHLDWIREKS 254
            ..|..|..   .||..:..|||||.:.|
  Fly   243 VAGFFSSDLDHQGYLNIRPHLDWISKNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 61/240 (25%)
Tryp_SPc 35..250 CDD:214473 59/237 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 35/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.