DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and spirit

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:112/260 - (43%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPY--AVGLRMNNGA----VGGGSVIGNNWVLTAAHC------------LTTDS 81
            :|.|.|....:.|:  |:|.|.|...    ..||::|.||:|||||||            |..|:
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    82 VTIHYGSNRAWNGQLQHTVNKNNFFRHPGY-PNSAGHDIGLIRTPYVSFTNLINKVSLPK----- 140
            :|:..|.:          ::......||.| .::|.:||.|:.         :...:.|:     
  Fly   197 LTLTEGED----------ISIRRVIIHPDYSASTAYNDIALLE---------LETAAKPELKPTC 242

  Fly   141 -FSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQV--ISNGECARSY------GSVASTDMC 196
             ::||  ...|....|.|:|..:..||:. .|.:.|.:  :||.||...|      ..|..|.||
  Fly   243 IWTQK--EVTNTLVTAIGYGQTSFAGLSS-AQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMC 304

  Fly   197 TRATDG-KSVCGGDSGGALVTHDNPIQVGV-ITFASIGCKSG-PSGYTRVSDHLDWIREKSGIAY 258
            .....| :..|.|||||.|:..|..:...| ||....||.|| ||.|||||..:|||   .||.:
  Fly   305 AGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWI---EGIVW 366

  Fly   259  258
              Fly   367  366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 77/253 (30%)
Tryp_SPc 35..250 CDD:214473 75/250 (30%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 77/256 (30%)
Tryp_SPc 132..361 CDD:214473 75/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.