DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG11664

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:271 Identity:66/271 - (24%)
Similarity:106/271 - (39%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKLVLLLLFVATVCAHRNRNRTAHHGGGPKDIIVNGY------PAYEGKAPYAVGLRMNNGAVGG 61
            :.|.|:||.:|.      |...|.|.|.|......||      |.:                :..
  Fly     6 ESLQLILLAIAV------RWGDALHRGIPVQQQNYGYVMQIYGPQF----------------LAA 48

  Fly    62 GSVIGNNWVLTAAHCL----TTDSVTIHYGSN-RAWNGQLQHTVNKNNFFRHPGY-PNSAGHDIG 120
            ||:....:|||.|||.    ..:.:::..|.. .||..:.:...   ...|||.: |.:..:||.
  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVA---GLLRHPKFSPLTLRNDIA 110

  Fly   121 LIRT-PYVSFTNLINKVS--------LPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQ 176
            ::|. ..:|.:::||.:.        |..|:...|        ..||..|   .:|..|:.|.||
  Fly   111 VLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQE--------LAGWNLM---HIAQPLKSMSVQ 164

  Fly   177 VISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSGPSGYT 241
            |.....|.:.:..::...:|..||.|:.:|.||||..|::......: .|.|...|.|..|:.:|
  Fly   165 VEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGDPLISGGEVCGL-AIAFRKCGDKRYPALFT 228

  Fly   242 RVSDHLDWIRE 252
            .|..|..:|.:
  Fly   229 DVHYHRAFIAQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 56/239 (23%)
Tryp_SPc 35..250 CDD:214473 55/235 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/231 (23%)
Tryp_SPc 38..237 CDD:214473 53/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.