DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Prss34

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:281 Identity:84/281 - (29%)
Similarity:120/281 - (42%) Gaps:46/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLLLFVATVCAHRNRNRTAHHGGGPKDI--IVNGYPAYEGKAPYAVGLRMNNGAVG------GG 62
            :|..||:...|.......|...|   :::  ||.|.|....:.|:.|.||..|..:.      ||
  Rat     5 MLWFLFLTLPCLGSTMPLTPDSG---QELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGG 66

  Fly    63 SVIGNNWVLTAAHC-----LTTDSVTIHYGSNRAW-NGQLQHTVNKNNFFRHPGYPNS----AGH 117
            |:|...||||||||     :......:..|..|.: |.||....   ...|||.:...    .|.
  Rat    67 SLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVA---KIIRHPKFSEKLSAPGGA 128

  Fly   118 DIGLIR-TPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQC----MDVQV 177
            ||.|:: ...|..:..::.||||..||:....:.||  ..|| |:..|.......|    :.|.:
  Rat   129 DIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWW--VAGW-GVIEGHRPLPPPCHLREVAVPI 190

  Fly   178 ISNGECARSYGSVASTDMCTR---------ATDGKSVCGGDSGGALVTHDNP--IQVGVITFASI 231
            :.|.:|.:.|.:.:|.|..|:         ..:|:..|..||||.||...|.  :||||::: .|
  Rat   191 VGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSW-GI 254

  Fly   232 GC--KSGPSGYTRVSDHLDWI 250
            ||  ...|..||||..:|.||
  Rat   255 GCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 78/250 (31%)
Tryp_SPc 35..250 CDD:214473 76/248 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 78/250 (31%)
Tryp_SPc 33..275 CDD:214473 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.