DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG18636

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:123/270 - (45%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGA-VGGGSVIGNNWVLTAA 74
            |:...|..|.::|||:.       |:||:.|....:|:.|.|...... |.|||:|.:..|||||
  Fly    28 FLDPACGIRTQSRTAYR-------IINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAA 85

  Fly    75 HCLTTDSVTI----HYGSNRA-------WNGQLQHTVNKNNFFRHPGY-PNSAGHDIGLIR-TPY 126
            ||...:...:    .|...|:       .|.:.:|.|:..  |:|..| ||:..:||.::| :..
  Fly    86 HCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAG--FKHKLYDPNTHANDIAILRLSKS 148

  Fly   127 VSFTNLINKVSLPKFSQKGERFENWW---------CVACGWGGMANGGLADWLQCMDVQVISNGE 182
            |.:.:.|..:.:.        :::.|         ..|.|||.......:|.||.:|::......
  Fly   149 VVYRDNIRPICVV--------WDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDV 205

  Fly   183 CARSYG-SVASTDMCTRATDGKSVCGGDSG---GALVTHDNP---IQVGVITFASIGCKSGPSGY 240
            ||:..| ::|....|....| .::|.||||   ||::||.|.   :|||:.::.:..|:.. |.:
  Fly   206 CAKFIGQTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA-SVF 268

  Fly   241 TRVSDHLDWI 250
            |.|..|.::|
  Fly   269 TDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 68/246 (28%)
Tryp_SPc 35..250 CDD:214473 67/244 (27%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/252 (27%)
Tryp_SPc 45..278 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.