DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG33461

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:102/253 - (40%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTD-SVTIHYGSNRAWNG---- 94
            |:||.||..|:.|:...|......:..||:|...:|||:|||:..| .:....|.|...|.    
  Fly    42 IINGTPARLGRYPWMAFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCE 106

  Fly    95 -----QLQHTVNKNNFFRHPGY-PNSAGHDIGLIRTP-YVSFTNLINKVSLPKFSQKGERF---E 149
                 :.....|.:..|:|..| |....:|||::|.. .|.:|..|..:.:  |..:..:.   :
  Fly   107 NNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICI--FHHRRMQLVVDQ 169

  Fly   150 NWWCVACGWGGMANGGLADWLQCMDVQVISN-------------GECARSY-GSVASTDMCTRAT 200
            ..|..|.|||          |...|:...|:             .:|||.: .:..|..:|....
  Fly   170 ITWFKATGWG----------LTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGND 224

  Fly   201 DGKSVCGGDSGG------ALVTHDNPIQVGVITFASIGCKSGPSGYTRVSDHLDWIRE 252
            || ::|.|||||      .:......:|:|:.:|....| |..|..|.|..:..||::
  Fly   225 DG-NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENC-SKVSILTDVVRYGRWIKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/253 (26%)
Tryp_SPc 35..250 CDD:214473 63/249 (25%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 63/249 (25%)
Tryp_SPc 42..281 CDD:238113 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.