DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Sp212

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:109/266 - (40%) Gaps:65/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGPKDIIVNGYPAYEGKAPY----------AVGLRMNNGAVGGGSVIGNNWVLTAAHC---LTTD 80
            |.....||.|.....|:.|:          |:..:..      ||:|.::.|::||||   :|.|
  Fly   271 GSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCR------GSLISSSIVISAAHCVHRMTED 329

  Fly    81 SVTI--------HYGSNRAWNGQLQHTVNKNNFFR---HPGYPNSAGH---DIGL--IRTPYVSF 129
            .|.:        .||.:.|         ...|..|   ||.| |:..:   ||.|  |..| |:|
  Fly   330 RVVVGLGRYDLDDYGEDGA---------EMRNVMRLLWHPDY-NTRSYSDADIALITIERP-VTF 383

  Fly   130 TNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYGSVASTD 194
            .::|..:.:  ::.:..|..:......|||...:.....:.:.::.::.|...||.::.....|:
  Fly   384 NDIIAPICM--WTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTE 446

  Fly   195 --MCTRATDGKSVCGGDSGGALVTH--DNPIQVGVITFASIGCKSGPSG---------YTRVSDH 246
              :|....||...|.|||||.|:..  |..:..|::   |.| :.||:|         |..:|.|
  Fly   447 RSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIV---SAG-ERGPAGTCQLNQYVLYCDLSKH 507

  Fly   247 LDWIRE 252
            ::||.|
  Fly   508 INWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/260 (25%)
Tryp_SPc 35..250 CDD:214473 62/256 (24%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 65/260 (25%)
Tryp_SPc 277..511 CDD:214473 62/256 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.