DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG30187

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:232 Identity:60/232 - (25%)
Similarity:91/232 - (39%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDSV-TIHYG----SNRAWNG 94
            |..|:.|....:.:...:......:.||::|...:|||||||:....| ::..|    |:.|...
  Fly    36 ITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDPADRK 100

  Fly    95 QLQHTVNKNNFFRHPGYPNSAGHDIGLIR-TPYVSFTNLINKVSLPKFSQKGERFENWWCV-ACG 157
            .:...|..::|.....|.|    ||||:: :..|.|..||..:.:...........|.... |.|
  Fly   101 DVITAVVHSSFDVRASYEN----DIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFG 161

  Fly   158 WGGMANGGLADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHD---- 218
            ||.:.....:|.||.:.:..:...||........|.............|||||||.| |:|    
  Fly   162 WGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQICAGVPSGDTCGGDSGGPL-TNDVFIQ 225

  Fly   219 ----NPIQVGVITFASIGCKSGPSGYTRVSDHLDWIR 251
                ..:|.|:|:.....| .|...||.:....|||:
  Fly   226 GIGNREVQFGIISVGKTSC-DGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 60/232 (26%)
Tryp_SPc 35..250 CDD:214473 58/229 (25%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 58/229 (25%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.