DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG30098

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:234 Identity:60/234 - (25%)
Similarity:101/234 - (43%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL-TTDSVTI---HYGSNRAWNGQ 95
            ::.|..|  .:.|:...|..:|....|||:|...:|||||||. ..|::.:   .|.|:|..:||
  Fly    37 VIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQ 99

  Fly    96 LQHTVNKNNFFRHPGYPNSAGHDIGLIR-------TPYVSFTNLINKVSLPKFSQKGERFENWWC 153
            .: :....:.:||..|.:...|||.:::       ..|:....::....|...:...:.|     
  Fly   100 TR-SYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF----- 158

  Fly   154 VACGWGGMAN-GGLADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSG---GAL 214
            ...|||.||: ..:...||.|.::.:.|..|     .|.|..:|. ....:..|.||||   |:|
  Fly   159 TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-----GVPSLSICC-WNPVQYACFGDSGGPLGSL 217

  Fly   215 VTHDNP---IQVGVITFASIGCKSGPSGYTRVSDHLDWI 250
            |.:.:.   :|.||....:..| .|.|.|..:..::.|:
  Fly   218 VKYGHKTIYVQFGVTNSVTGNC-DGYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 60/234 (26%)
Tryp_SPc 35..250 CDD:214473 59/232 (25%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/231 (26%)
Tryp_SPc 37..258 CDD:238113 60/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.