DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG30087

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:270 Identity:69/270 - (25%)
Similarity:119/270 - (44%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAH 75
            |:..:|.....::||..       :|||..|....||:.|.:..|:....|||::.:.::|||||
  Fly    25 FLNPLCGVTYESQTAMR-------VVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAH 82

  Fly    76 C-------------LTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGH--DIGLIR-T 124
            |             :.||...  .|||.:...: ::.:.|  ...|..| |:|.|  ||.|:: .
  Fly    83 CVFPNLRLRLGEHNIRTDPDC--QGSNCSPRSE-EYGIMK--AITHRFY-NAANHVNDIALLKLN 141

  Fly   125 PYVSFT-------NLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGE 182
            ..::|.       .|:|..|.|..:    .::.:     |||.....|....||..:::......
  Fly   142 RSINFNVHIQPICILLNPASAPSVA----TYQTF-----GWGETKKNGFPHLLQTAELRAYDAAY 197

  Fly   183 CARSYGSVASTDMCTRATDGKSVCGGDSGGALVTH------DNPIQVGVITFASIGCKSGPSGYT 241
            |:||:.:..:.:......:.:..|.|||||.|||.      ...:|:|::::....|:| |..||
  Fly   198 CSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS-PGVYT 261

  Fly   242 RVSDHLDWIR 251
            .|.::::|||
  Fly   262 YVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/246 (26%)
Tryp_SPc 35..250 CDD:214473 62/243 (26%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 62/251 (25%)
Tryp_SPc 42..272 CDD:238113 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.