DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Ctrb1

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:237 Identity:69/237 - (29%)
Similarity:111/237 - (46%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNG-AVGGGSVIGNNWVLTAAHC-LTTDSVTIHYGSNRAWNGQLQ 97
            ||||..|..|..|:.|.|:...| ...|||:|..:||:||||| :.|..|.:        .|:..
  Rat    34 IVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVV--------AGEFD 90

  Fly    98 HTVNKNNF--------FRHPGYPN-SAGHDIGLIR--TPYVSFTNLINKVSLPKFSQKGERF-EN 150
            ...::.|.        |::|.:.. :..:||.|::  || ..|:..::.|.||...   :.| ..
  Rat    91 QGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATP-AQFSETVSAVCLPNVD---DDFPPG 151

  Fly   151 WWCVACGWGGMANGGL--ADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGA 213
            ..|...|||......|  .:.||...:.::|..:|.:|:||..:..|......|.|.|.|||||.
  Rat   152 TVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGP 216

  Fly   214 LVTHDNPI--QVGVITFASIGCK-SGPSGYTRVSDHLDWIRE 252
            ||...:.:  ..|::::.|..|. |.|:.|:||:..:.|:::
  Rat   217 LVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 69/237 (29%)
Tryp_SPc 35..250 CDD:214473 68/233 (29%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 68/233 (29%)
Tryp_SPc 34..259 CDD:238113 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.